Welcome to LookChem.com Sign In|Join Free
  • or
Home > Pharmaceutical > 69 > 

69-78-3

Basic Information
CAS No.: 69-78-3
Name: 3-Carboxy-4-nitrophenyl disulfide
Article Data: 21
Molecular Structure:
Molecular Structure of 69-78-3 (3-Carboxy-4-nitrophenyl disulfide)
Formula: C14H8N2O8S2
Molecular Weight: 396.358
Synonyms: 2,2'-Dinitro-5,5'-dithiodibenzoicacid;3,3'-Dithiobis(6-nitrobenzoic acid);5,5'-Dithiobis[2-nitrobenzoic acid];Ba 2767;Dithionitrobenzoic acid;DTNB;
EINECS: 200-714-4
Density: 1.787 g/cm3
Melting Point: 240-245 °C (dec.)(lit.)
Boiling Point: 671.863 °C at 760 mmHg
Flash Point: 360.13 °C
Solubility: Soluble in water and ethanol.
Appearance: Yellow solid.
Hazard Symbols: IrritantXi
Risk Codes: 36/37/38
Safety: 26-36
PSA: 216.84000
LogP: 4.74520
Synthetic route
6950-43-2

5-bromo-2-nitrobenzoic acid

69-78-3

5,5'-dithiobis-(2-nitrobenzoic acid)

Conditions
ConditionsYield
With sodium sulfide In water at 50℃; for 2h; pH=> 3.5;72.3%
2516-95-2

5-chloro-2-nitrobenzoic acid

69-78-3

5,5'-dithiobis-(2-nitrobenzoic acid)

Conditions
ConditionsYield
With sodium sulfide; sodium hydroxide anschliessendes Behandeln mit Jod und KI;
75-91-2

tert.-butylhydroperoxide

15139-21-6

5-thio-2-nitrobenzoic acid

A

69-78-3

5,5'-dithiobis-(2-nitrobenzoic acid)

B

75-65-0

tert-butyl alcohol

Conditions
ConditionsYield
With ethylenediaminetetraacetic acid; MES buffer; selenosubtilisin (ESeSAr form) at 25℃; Rate constant; pH 5.5; other seleno- reagent, (Km)t-BuOOH;
15139-21-6

5-thio-2-nitrobenzoic acid

69-78-3

5,5'-dithiobis-(2-nitrobenzoic acid)

Conditions
ConditionsYield
With potassium hydroxide; dihydrogen peroxide In water
With dithionite(2-); cetyltrimethylammonim bromide In water Equilibrium constant;
With NaOH buffer; 1-phenylethyl hydroperoxide; seleno-subtilisin Carlsberg; citric acid at 20℃; pH=5.5; Enzyme kinetics; Oxidation;
77874-90-9

3-carboxylate-4-nitrothiophenoxide ion

69-78-3

5,5'-dithiobis-(2-nitrobenzoic acid)

Conditions
ConditionsYield
With 1-oxido-1,2-benziodoxol-3(1H)-one In water at 25℃; Kinetics; Rate constant; Mechanism; pH=8, μ=00.1(KCl), the reagent and the title compound were microencapsulated in vesicles of dioctadecyldimethylammonium chloride;
80-15-9

Cumene hydroperoxide

15139-21-6

5-thio-2-nitrobenzoic acid

A

69-78-3

5,5'-dithiobis-(2-nitrobenzoic acid)

B

617-94-7

1-methyl-1-phenylethyl alcohol

Conditions
ConditionsYield
Stage #1: 5-thio-2-nitrobenzoic acid With supramolecular artificial glutathione peroxidase (SGPxmax) In aq. phosphate buffer at 36℃; for 0.05h; pH=7; Enzymatic reaction;
Stage #2: Cumene hydroperoxide In aq. phosphate buffer Kinetics; Catalytic behavior; Reagent/catalyst;
With C17H28O3Te In aq. phosphate buffer; ethanol at 25℃; pH=7; Kinetics; Solvent;

C18H27NO5SSe

A

69-78-3

5,5'-dithiobis-(2-nitrobenzoic acid)

B

1204351-95-0

bis(11-hydroxyundecyl) diselenide

Conditions
ConditionsYield
Irradiation;
591-17-3

meta-bromotoluene

69-78-3

5,5'-dithiobis-(2-nitrobenzoic acid)

Conditions
ConditionsYield
Multi-step reaction with 3 steps
1: nitric acid; sulfuric acid / 2 h / 45 - 55 °C
2: potassium permanganate / water / 50 °C
3: sodium sulfide / water / 2 h / 50 °C / pH > 3.5
View Scheme
69-78-3

5,5'-dithiobis-(2-nitrobenzoic acid)

MGSSHHHHHHSSGLVPRGSASQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGR TLSDYNIQKESTLHLVLRLRGC disulfide

MGSSHHHHHHSSGLVPRGSASQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGR TLSDYNIQKESTLHLVLRLRGC disulfide

MGSSHHHHHHSSGLVPRGSASQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGR TLSDYNIQKESTLHLVLRLRGC* (C* = Cys-SS-3-carboxy-4-nitrophenyl)

MGSSHHHHHHSSGLVPRGSASQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGR TLSDYNIQKESTLHLVLRLRGC* (C* = Cys-SS-3-carboxy-4-nitrophenyl)

Conditions
ConditionsYield
Stage #1: MGSSHHHHHHSSGLVPRGSASQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGR TLSDYNIQKESTLHLVLRLRGC disulfide With D,L-dithiothreitol In aq. phosphate buffer at 37℃; for 0.333333h; pH=7.4;
Stage #2: 5,5'-dithiobis-(2-nitrobenzoic acid) In aq. phosphate buffer at 20℃; for 0.0333333h; pH=7.4;
100%
69-78-3

5,5'-dithiobis-(2-nitrobenzoic acid)

15139-21-6

5-thio-2-nitrobenzoic acid

Conditions
ConditionsYield
With sodium tetrahydroborate In ethanol; water at 0 - 20℃;97%
With dithionite(2-); cetyltrimethylammonim bromide In water Kinetics; Equilibrium constant; further reagents, catalysts;
With 2-(N,N-dimethylamino)ethanol; 2-mercaptoethylamine hydrochloride In water at 25℃; for 1h; Yield given;
  • Display:default sort

    New supplier

  • 3-Carboxy-4-nitrophenyl disulfide

  • Casno:

    69-78-3

    3-Carboxy-4-nitrophenyl disulfide

    Min.Order: 1 Kilogram

    FOB Price:  USD $ 3.0-3.0

    As a leading manufacturer and supplier of chemicals in China, DayangChem not only supply popular chemicals, but also DayangChem's R&D center offer custom synthesis services. DayangChem can provide different quantities of custom synthesis ch

    Dayang Chem (Hangzhou) Co.,Ltd. dedicated to the development, production and marketing of chemicals which is specialized in Organic compounds; Active Pharmaceutical Ingredi

  •  Dayang Chem (Hangzhou) Co.,Ltd.

     China (Mainland)  |  Contact Details

    Business Type:Lab/Research institutions

    Tel:+86-571-88938639

    Address:9/F, Unit 2 Changdi Torch Building, 259# WenSan Road, Xihu District, Hangzhou City 310012, P.R.China

       Inquiry Now

  • High quality 5,5’-Dithiobis(2-Nitrobenzoic Acid) with high purity

  • Casno:

    69-78-3

    High quality 5,5’-Dithiobis(2-Nitrobenzoic Acid) with high purity

    Min.Order: 1 Kilogram

    FOB Price:  USD $ 0.0-0.0

    Welcome to Simagchem, your partner in China as a premier supply of bulk specialty chemicals for industry and life science. We introduce experienced quality product and exceptional JIT service with instant market intelligence in China to benefit our

    Welcome to Simagchem, your partner in China as a premier supply of bulk specialty chemicals for industry and life science. We introduce experienced quality product and exceptional

  •  Simagchem Corporation

     China (Mainland)  |  Contact Details

    Business Type:Manufacturers

    Tel:+86-592-2680277

    Address:21/F Hualong Office Building,No.6 Hubin East Road, Xiamen,China

       Inquiry Now

  • CAS:69-78-3 3-Carboxy-4-nitrophenyl disulfide/DTNB

  • Casno:

    69-78-3

    CAS:69-78-3 3-Carboxy-4-nitrophenyl disulfide/DTNB

    Min.Order: 1 Kilogram

    FOB Price:  USD $ 0.0-0.0

    Product name 3-Carboxy-4-nitrophenyl disulfide Synonyms 5,5'-Dithiobis(2-nitrobenzoic acid); 6,6'-Dinitro-3,3'-dithiodibenzoic acid; Bis(3-carboxy-4-nitrophenyl) disulfid

    Kono Chem Co.,Ltd is a leading producer of standardized herbal extracts, natural active ingredients and APIs for pharmaceutical, health food and cosmetic industries. Annually, mo

  •  Kono Chem Co.,Ltd

     China (Mainland)  |  Contact Details

    Business Type:Other

    Tel:86-29-86107037-8015

    Address:No.11 Daqing Road,Lianhu District,Xi’an 710082,China

       Inquiry Now

  • High purity 5,5′-Dithiobis(2-nitrobenzoic acid) DTNB CAS 69-78-3 used as biochemical reagent

  • Casno:

    69-78-3

    High purity 5,5′-Dithiobis(2-nitrobenzoic acid) DTNB CAS 69-78-3 used as biochemical reagent

    Min.Order: 100 Gram

    FOB Price:  USD $ 10.0-10.0

    High purity 5,5′-Dithiobis(2-nitrobenzoic acid) DTNB CAS 69-78-3 used as biochemical reagent Company profile Wuhan Fortuna Chemical Co.,Ltd established in 2006, is a big integrative chemical enterprise being engaged in Pharmaceutical &

    Wuhan Fortuna Chemical Co., Ltd, located in the predominant Wu Han City where is a traffic hinge of China, is a big integrative chemical enterprise being engaged in producing and

  •  Wuhan Fortuna Chemical Co.,Ltd

     China (Mainland)  |  Contact Details

    Business Type:Trading Company

    Tel:86-27-59207852

    Address:Add: Room 2015, No.2 Building, Kaixin Mansion No.107 Jinqiao Avenue, Wuhan, China

       Inquiry Now

  • 5,5'-Dithiobis(2-nitrobenzoic Acid) [for DeterMination of SH groups]

  • Casno:

    69-78-3

    5,5'-Dithiobis(2-nitrobenzoic Acid) [for DeterMination of SH groups]

    Min.Order: 1 Kilogram

    FOB Price:  USD $ 0.0-0.0

    he company has advanced technology, as well as a large number of excellent R & D team, to provide customers from the grams to one hundred kilograms and tons of high-quality products, competitive prices and quality se T rvice Appearance:White or

    Located in Zhengdong New District,?Zhengzhou of Henan province, Henan Allgreen Chemical Co.,Ltd is a comprehensive high-tech modern enterprises integrating professional R&D, pro

  •  Henan Allgreen Chemical Co.,Ltd

     China (Mainland)  |  Contact Details

    Business Type:Manufacturers

    Tel:+86-0371-87507775

    Address:No 260 Dongming Road,Jinshui District

       Inquiry Now

  • Factory Supply 5,5’-Dithiobis(2-Nitrobenzoic Acid)

  • Casno:

    69-78-3

    Factory Supply 5,5’-Dithiobis(2-Nitrobenzoic Acid)

    Min.Order: 1

    FOB Price:  USD $ 0.0-0.0

    The above product is Ality Chemical's strong item with best price, good quality and fast supply. Ality Chemical has been focusing on the research and production of this field for over 14 years. At the same time, we are always committed to providi

    Ality Chemical, established in 2007, is a comprehensive Chemical Production&Supply Group with Patent Technology as its core. Ality Chemical operates sales branches in Shanghai, Xia

  •  Ality Chemical Corporation

     China (Mainland)  |  Contact Details

    Business Type:Other

    Tel:0513-87616220

    Address:Fine chemical industry park, Nantong,Jiangsu

       Inquiry Now

  • Best Price of 5.5-Dithiobis(2-nitrobenzoic acid) (DTNB)

  • Casno:

    69-78-3

    Best Price of 5.5-Dithiobis(2-nitrobenzoic acid) (DTNB)

    Min.Order: 1 Kilogram

    FOB Price:  USD $ 1.0-1000.0

    We could give you: 1. Best quality in your requirement 2. Competitive price in China market 3. mature Technical support 4. Professional logistic support 5 . Full experience of large numbers containers loading in Chinese sea p

    Yuan Shi(SuQian)Biotechnology Co.,Ltd.is a comprehensive hi-tech enterprise. Our businesses include scientific research, development, production & international trade. we are a lea

  •  Yuan Shi(SuQian)Biotechnology Co.,Ltd

     China (Mainland)  |  Contact Details

    Business Type:Manufacturers

    Tel:+86-527-84226675

    Address:jiangsu suqian

       Inquiry Now

  • 3,3'-Dithiobis-(6-nitrobenzoic acid)

  • Casno:

    69-78-3

    3,3'-Dithiobis-(6-nitrobenzoic acid)

    Min.Order: 5 Kiloliter

    FOB Price:  USD $ 1.2-5.0

    Our main production base is located in Xuzhou industry park. We are certified both to the ISO 9001 and ISO 14001 Standards, have a safety management system in place.Our R&D team masters core technology for process-design of target building block

    Our main production base is located in Xuzhou industry park. We produce a wide range of organics including Fine chemicals, Active pharmaceutical ingredients(APIs), Veterinary, In

  •  Chemwill Asia Co., Ltd.

     China (Mainland)  |  Contact Details

    Business Type:Manufacturers

    Tel:021-51086038

    Address:High-Tech Industrial park,Chemical Economical Development Zone,Xuzhou, Jiangsu-Province, P.R.China

       Inquiry Now

  • 5,5′-Dithiobis(2-nitrobenzoic acid)

  • Casno:

    69-78-3

    5,5′-Dithiobis(2-nitrobenzoic acid)

    Min.Order: 1 Kilogram

    FOB Price:  USD $ 3.0-10.0

    With our good experience, we offer detailed technical support and advice to assist customers. We communicate closely with customers to establish their quality requirements. Consistent Quality Our plant has strict quality control in each manufacturin

    Our company specializes in processing and selling chemical raw materials, chemical th Asia, Europe, America, Africa and other more than 20 countries and regions. ? Companies adheri

  •  Hebei Nengqian Chemical Import and Export Co., LTD

     China (Mainland)  |  Contact Details

    Business Type:Trading Company

    Tel:+86 18922142716

    Address:hebei

       Inquiry Now

  • 3-Carboxy-4-nitrophenyl disulfide 69-78-3

  • Casno:

    69-78-3

    3-Carboxy-4-nitrophenyl disulfide 69-78-3

    Min.Order: 1 Kilogram

    FOB Price:  USD $ 0.0-0.0

    3-Carboxy-4-nitrophenyl disulfide Basic information Product Name: 3-Carboxy-4-nitrophenyl disulfide Synonyms: DTNB;ellmann's reagent;ELLMAN'S REAGENT;ELLMANS' REAGENT;BIS(3-C

    Welcome to Henan Tianfu Chemical Co., Ltd. Our company engages in noble metal catalysts, synthesis of electronic chemical materials and Pharmaceutical, Agrochemicals, Food Additive

  •  Henan Tianfu Chemical Co., Ltd.

     China (Mainland)  |  Contact Details

    Business Type:Lab/Research institutions

    Tel:86-371-55170693/55170694

    Address:Zhengzhou International Trade New Territory,Jinshui District,Zhengzhou ,China

       Inquiry Now

  • Factory direct supply CAS 69-78-3 with best quality

  • Casno:

    69-78-3

    Factory direct supply CAS 69-78-3 with best quality

    Min.Order: 1 Kilogram

    FOB Price:  USD $ 139.0-210.0

    WITH US,YOUR MONEY IN SAFE,YOUR BUSINESS IN SAFE 1)Quick Response Within 12 hours; 2)Quality Guarantee: All products are strictly tested by our QC, confirmed by QA and approved by third party lab in China, USA, Canada, Germany, UK, Italy, France et

    Zhuo Zhou Wen Xi Import and Export Co., Ltd. is a company mainly engaged in the export of pharmaceutical raw materials. Its parent company is (Wen Xi Pharma), including three subs

  •  Zhuozhou Wenxi import and Export Co., Ltd

     China (Mainland)  |  Contact Details

    Business Type:Trading Company

    Tel:+86-13111626072

    Address:Room 1710, Baoxin International Phase I, 19 Guanyun East Road, Zhuozhou, Hebei

       Inquiry Now

  • 5,5-Dithiobis(2-nitrobenzoic acid)

  • Casno:

    69-78-3

    5,5-Dithiobis(2-nitrobenzoic acid)

    Min.Order: 1 Kilogram

    FOB Price:  USD $ 1.0-1.0

    Name: 5,5-Dithiobis(2-nitrobenzoic acid) Molecular formula:C14H8N2O8S2 Molecular wt:396.34 CAS:69-78-3 Appearance:white-light yellow crystal powder Storage:Store in cool and dry place, away from sun light. Package:25kg Application:used in all kinds

    Welcome to Henan Sinotech! Sinotech Corporation has exceptional sourcing ability for chemicals used in Organic Fine Chemicals and APIs; Inorganic chemicals; Flame Retardants;OLED

  •  Henan Sinotech Import&Export Corporation

     China (Mainland)  |  Contact Details

    Business Type:Other

    Tel:86-371-86181678

    Address:No. 260, Dongming Road,Jinshui District

       Inquiry Now

  • 99% Purity DTNB 5,5-Dithio-bis(2-nitrobenzoic acid)

  • Casno:

    69-78-3

    99% Purity DTNB 5,5-Dithio-bis(2-nitrobenzoic acid)

    Min.Order: 1 Kilogram

    FOB Price:  USD $ 1.0-1.0

    Appearance:White-light yellow crystal powder Storage:R.T Package:500G/Bottle or at customers requirement. Application:Widely used in biochemical research, it is a sensitive determination reagent for the research and production of biochemical reactio

    Founded in 2005, Sartort, located in Hangzhou, is a leading company engaging in chemistry, pharmaceutical and advanced materials. At present, Sartort has such controlled subsidi

  •  Hangzhou Sartort Biopharma Co., Ltd

     China (Mainland)  |  Contact Details

    Business Type:Lab/Research institutions

    Tel:86-571-87039693

    Address:No. 57, Tech Park Road, Hangzhou, Zhejiang, China

       Inquiry Now

  • 3-Carboxy-4-nitrophenyl disulfide 69-78-3

  • Casno:

    69-78-3

    3-Carboxy-4-nitrophenyl disulfide 69-78-3

    Min.Order: 1 Kilogram

    FOB Price:  USD $ 0.0-0.0

    1.No Less 8 years exporting experience. Clients can 100% received goods 2.Lower Price with higher quality 3,Free sample 4,We are sincerely responsible for the "product quality" and "After Service" Upbio is Specialized

    Shanghai Upbio Tech Co.,Ltd (Former Onchem (China)Co.,Ltd) is a comprehensive manufacturer and an international distribution of chemicals throughout the world, The predecessor of

  •  Shanghai Upbio Tech Co.,Ltd

     China (Mainland)  |  Contact Details

    Business Type:Lab/Research institutions

    Tel:+86-21-52196435

    Address:No.2 Floor,No.979 Yunhan Rd,Nicheng,Pudong New Area,Shanghai,China

       Inquiry Now

  • 5,5′-Dithiobis(2-nitrobenzoic acid) CAS:69-78-3

  • Casno:

    69-78-3

    5,5′-Dithiobis(2-nitrobenzoic acid) CAS:69-78-3

    Min.Order: 1 Gram

    FOB Price:  USD $ 0.0-0.0

    5,5′-Dithiobis(2-nitrobenzoic acid) CAS:69-78-3 Qingdao Belugas Import and Export Co., Ltd. is a scientific and technological company integrating research and development, production and trade of chemical intermediates, specializing in high qu

    Qingdao Belugas Import and Export Co., Ltd. is a scientific and technological company integrating research and development, production and trade of chemical intermediates, speciali

  •  Qingdao Beluga Import and Export Co., LTD

     China (Mainland)  |  Contact Details

    Business Type:Lab/Research institutions

    Tel:+8613854236000

    Address:qingdao

       Inquiry Now

  • 3-Carboxy-4-nitrophenyl disulfide

  • Casno:

    69-78-3

    3-Carboxy-4-nitrophenyl disulfide

    Min.Order: 1 Kilogram

    FOB Price:  USD $ 0.0-0.0

    Hello, dear friend! I'm Hansen and Allen from China. Welcome to my lookchem mall! The following is a brief introduction of our company's products and services. If you are interested in our products, please contact us by emai

    Shandong Hanjiang Chemical Co., Ltd. is located in Zibo City, Shandong Province, China. It is a biotechnology enterprise engaged in the R&D, production and sales of drugs, steroids

  •  Shandong Hanjiang Chemical Co., Ltd.

     China (Mainland)  |  Contact Details

    Business Type:Lab/Research institutions

    Tel:+86 18369939125

    Address:No.25A Qilu Industrial Park

       Inquiry Now

  • CAS NO.:69-78-3

  • Casno:

    69-78-3

    CAS NO.:69-78-3

    Min.Order: 0

    FOB Price:  USD $ 0.0-0.0

    Henan Wentao Chemical Product Co.,Ltd is Located in Zhengzhou High-tech Development Zone with import and export license, We passed ISO 9001:2008 as well, Henan Wentao has developed more than 1000 compounds, which are widely used in the fields of prod

    The company is Located in Zhengzhou High-tech Development Zone with import and export license, We passed ISO 9001:2008 as well, Henan Wentao has developed more than 1000 compounds,

  •  Henan Wentao Chemical Product Co., Ltd.

     China (Mainland)  |  Contact Details

    Business Type:Lab/Research institutions

    Tel:+86-370-2722992

    Address:32 Room, 5th Floor, Building 11, No. 6 Yinxing Road, High-tech Industrial Development Zone, Zhengzhou City, Henan Province

       Inquiry Now

  • 5,5’-Dithiobis(2-Nitrobenzoic Acid)

  • Casno:

    69-78-3

    5,5’-Dithiobis(2-Nitrobenzoic Acid)

    Min.Order: 0

    FOB Price:  USD $ 0.0-0.0

    Best quality & Attractive price & Professional service; Trial & Pilot & Commercial Hisunny Chemical is a leading manufacturer and supplier of chemicals in China. We develop produce and distribute high quality intermediates, specia

    Hisunny Chemical is a leading manufacturer and supplier of chemicals in China. We develop produce and distribute high quality intermediates, special chemicals and OLED materials &

  •  Xiamen Hisunny Chemical Co.,Ltd

     China (Mainland)  |  Contact Details

    Business Type:Manufacturers

    Tel:86-592-3327115

    Address:Unit 603,No.879,Xiahe Road,Meixin Building,Xiamen,China

       Inquiry Now

  • 3-Carboxy-4-nitrophenyl disulfide

  • Casno:

    69-78-3

    3-Carboxy-4-nitrophenyl disulfide

    Min.Order: 0 Metric Ton

    FOB Price:  USD $ 0.0-0.0

    Hangzhou KeyingChem Co., Ltd. exported this product to many countries and regions at best price. If you are looking for the material’s manufacturer or supplier in China, KeyingChem is your best choice. Pls contact with us freely for getting det

    Hangzhou Keying Chem Co., Ltd. Is a comprehensive enterprise, dedicated to the development, production and marketing of chemicals. As a technology innovative and service profession

  •  Hangzhou Keyingchem Co.,Ltd

     China (Mainland)  |  Contact Details

    Business Type:Lab/Research institutions

    Tel:+86-571-85378921

    Address:Jintong international Building, No.113,Huayuangang Street, Gong shu District, Hangzhou,Zhejiang, China.

       Inquiry Now

  • 3-Carboxy-4-nitrophenyl disulfide

  • Casno:

    69-78-3

    3-Carboxy-4-nitrophenyl disulfide

    Min.Order: 0

    FOB Price:  USD $ 0.0-0.0

    J&H CHEM R&D center can offer custom synthesis according to the contract research and development services for the fine chemicals, pharmaceutical, biotechnique and some of the other chemicals. J&H CHEM has some Manufacturing base in Jia

    J&H Chemical is one of China's leading providers of integrated fine chemical services including offering, research and development, Custom manufacturing business, as well as other

  •  Hangzhou J&H Chemical Co., Ltd.

     China (Mainland)  |  Contact Details

    Business Type:Lab/Research institutions

    Tel:+86-571-87396432

    Address:No.200 Zhenhua Rd.Xihu Industrial Park, Hangzhou 310030, China

       Inquiry Now

  • 3-Carboxy-4-nitrophenyl disulfide

  • Casno:

    69-78-3

    3-Carboxy-4-nitrophenyl disulfide

    Min.Order: 1 Gram

    FOB Price:  USD $ 1.0-1.0

    Massive Chemical is certified with ISO9001 and ISO14001 manufacturer for this product. We will offer all documents as requirement for the materials which includes, Certificate of Analysis, Material Safety Data Sheet, and Method of Analysis and

    Shanghai Massive Chemical Technology Co., Ltd. is engaged in development, production and marketing Specialty Chemicals to satisfy the changing needs of the chemical industry. We sp

  •  Shanghai Massive Chemical Technology Co., Ltd.

     China (Mainland)  |  Contact Details

    Business Type:Lab/Research institutions

    Tel:+86 21 34943721

    Address:Room 435, 4th floor, Building 9, No. 2568 Gudai Road,Minhang District, Shanghai,

       Inquiry Now

  • High purity5,5′-Dithiobis(2-nitrobenzoic acid)(DTNB)DTNB

  • Casno:

    69-78-3

    High purity5,5′-Dithiobis(2-nitrobenzoic acid)(DTNB)DTNB

    Min.Order: 10 Gram

    FOB Price:  USD $ 100.0-100.0

    Zibo Hangyu Biotechnology Development Co., Ltd is a leading manufacturer and supplier of chemicals in China. We develop produce and distribute high quality pharmaceuticals, intermediates, special chemicals and OLED intermediates and other fine chemi

    Hangyu Biotech is a leading manufacturer and supplier of chemicals in China. We develop produce and distribute high quality pharmaceuticals, intermediates, special chemicals and O

  •  Zibo Hangyu Biotechnology Development Co., Ltd

    China (Mainland)  |  Contact Details

    Business Type:Lab/Research institutions

    Tel:86-15965530500

    Address:Room1701, Tianxing Building,Licheng district, jinan, Shandong, China

       Inquiry Now

  • Dtnb,Cas 69-78-3

  • Casno:

    69-78-3

    Dtnb,Cas 69-78-3

    Min.Order: 1 Gram

    FOB Price:  USD $ 0.0-0.0

    Dtnb,Cas 69-78-3Appearance:powder Storage:Store in a cool dry place and keep away from strong light Package:according to customers' requirements Application:in research Transportation:By air(EMS or EUB or FedEx or TNT ect...) or by sea(FOB or CIF or

    Established in 2010, located in Hangzhou Qinglan science park, lingruichem is a technical company mainly focus on the Custom synthesis, manufacturing, sales of chemicals to various

  •  Hangzhou Lingrui Chemical Co.,Ltd.

     China (Mainland)  |  Contact Details

    Business Type:Other

    Tel:86 571-88092529

    Address:201-B 2# Building Qinglan science park, 321# JinPeng Str. Xihu District Hangzhou City, PR.CHINA

       Inquiry Now

  • 5,5'-Dithiobis(2-nitrobenzoic acid) ,99%

  • Casno:

    69-78-3

    5,5'-Dithiobis(2-nitrobenzoic acid) ,99%

    Min.Order: 1 Gram

    FOB Price:  USD $ 0.0-0.0

    Product Details Grade: pharmaceutical grade Purity:99%+ ProductionCapacity: 1000 Kilogram/Month Scope of use: For scientific research only(The product must be used legally) Our Advantage 1. Best quality with competitive price. 2. Quick shipping,

    Zibo Dorne chemical technology co., LTD. is a biotechnology enterprise engaged in the R&D, production and sales of drugs, steroids, peptides, raw materials, vitamins, food additive

  •  Zibo Dorne chemical technology co. LTD

     China (Mainland)  |  Contact Details

    Business Type:Lab/Research institutions

    Tel:+86-18560316533

    Address:No. 416, 4th floor, zhongguancun science and technology city, no. 1, west 6th road, zhangdian district

       Inquiry Now

  • DTNB;5,5′-Dithiobis(2-nitrobenzoic acid) ;3-Carboxy-4-nitrophenyl disulfide;Ellmann's Reagent.99%

  • Casno:

    69-78-3

    DTNB;5,5′-Dithiobis(2-nitrobenzoic acid) ;3-Carboxy-4-nitrophenyl disulfide;Ellmann's Reagent.99%

    Min.Order: 1 Metric Ton

    FOB Price:  USD $ 0.0-0.0

    High quality, competitive price, fast delivery and first-class service we possesses have won the trust and praise of customers. Standard: BP/USP/EP The purity is equal or greater than 99%. As a supplier, we can provide high-quality products. Cle

    Henan Kanbei Chemical Co., Ltd. is a modern high-tech chemical enterprise integrating R&D, production and sales. The company has strong technical strength, advanced equipment, stri

  •  Henan Kanbei Chemical Co.,LTD

    China (Mainland)  |  Contact Details

    Business Type:Lab/Research institutions

    Tel:86-152-37804566

    Address:Evergrande Future City, intersection of Zhengkai Avenue and Sixteenth Street, Kaifeng Area, Henan Pilot Free Trade Zone

       Inquiry Now

  • 3-Carboxy-4-nitrophenyl disulfide

  • Casno:

    69-78-3

    3-Carboxy-4-nitrophenyl disulfide

    Min.Order: 1 Gram

    FOB Price:  USD $ 0.0-0.0

    Product Name: 5,5′-Dithiobis(2-nitrobenzoic acid) Synonyms: DTNB;ellmann's reagent;ELLMAN'S REAGENT;ELLMANS' REAGENT;BIS(3-CARBOXY-4-NITROPHENYL) DISULFIDE;3-CARBOXY-4-NITROPHENYL DISULFIDE;Ellmsn'sreagent;Bis(3-carboxy-4-

    SHANGHAI MINSTAR CHEMICAL CO., LTD. is a leading, experienced, professional supplier of API & intermediates, plant extract, food additive, fine chemicals and industry chemicals, et

  •  Shanghai Minstar Chemical Co., Ltd

     China (Mainland)  |  Contact Details

    Business Type:Lab/Research institutions

    Tel:0086-21-18019205509

    Address:BUILDING 8, NO.1098, CHUANSHA ROAD, SHANGHAI, CHINA

       Inquiry Now

  • 5,5-DITHIO-BIS(2-NITROBENZOIC ACID)

  • Casno:

    69-78-3

    5,5-DITHIO-BIS(2-NITROBENZOIC ACID)

    Min.Order: 0

    FOB Price:  USD $ 0.0-0.0

    Hangzhou Huarong Pharm Co., Ltd.established since 2006 , has been actively developing specialty products for Finished Dosages, APIs, Intermediates, and Fine chemicals markets in North America, Europe, Korea, Japan, Mid-East and all over the World. Hu

    Hangzhou Huarong Pharm Co., Ltd. established since 2009 , has been always focusing on supplying products and services to our clients in the field of small molecule drug. Huarong

  •  Hangzhou Huarong Pharm Co., Ltd.

     China (Mainland)  |  Contact Details

    Business Type:Trading Company

    Tel:+86-571-86758373

    Address:Room1707, 7Th Floor, Xin Chuanmei Industry Building , No.58 of Xintang Road, Jianggan District, Hangzhou, China.

       Inquiry Now

  • 69-78-3  CAS NO.69-78-3

  • Casno:

    69-78-3

    69-78-3 CAS NO.69-78-3

    Min.Order: 1 Metric Ton

    FOB Price:  USD $ 7.0-8.0

    1.Applied in food field.it can improve the immune system and prolong life. 2.Appliedin cosmetic field.it can improve the skin care. 3.Applied in pharmaceutical field.it can treat various dieases. 4.Our product quality assurance will make our customer

    KAISA GROUP INC.is the enterprise which is specialize in manfacturing and exporting avariety of Chemical in China. We have the strong economic base and comprehensive technology.We

  •  KAISA GROUP INC

    United States  |  Contact Details

    Business Type:Trading Company

    Tel:15131197030

    Address:1312 17th Street Suite 1402 Denver CO 80202

       Inquiry Now

  • 5,5'-Dithiobis(2-nitrobenzoic acid)

  • Casno:

    69-78-3

    5,5'-Dithiobis(2-nitrobenzoic acid)

    Min.Order: 0

    FOB Price:  USD $ 0.0-0.0

    Appearance:95%+ Package:R&D,Pilot run Transportation:per client require Port:Express ,Air, Sea

    Hunan chemfish Pharmaceutical co.,Ltd.located in Lugu High-tech industral park ,Hunan province . with its own R&D center and more than 10000㎡manufacture plant . Chemfish owns

  •  Hunan chemfish Pharmaceutical co.,Ltd

     China (Mainland)  |  Contact Details

    Business Type:Manufacturers

    Tel:0731-85567275

    Address:No.10048, xiangjiang centry bulding ,kaifu district ,changsha city ,Hunan

       Inquiry Now

  • 3-carboxy-4-nitrophenyl Disulfide

  • Casno:

    69-78-3

    3-carboxy-4-nitrophenyl Disulfide

    Min.Order: 0

    FOB Price:  USD $ 0.0-0.0

    High quality,stable supply chain.Appearance:white/off-white or light yellow Storage:Store in cool and dry place, keep away from strong light and heat. Package:aluminum bottle,glass bottle,PTFE bottle,cardboard drum Application:This product can be use

    Suzhou Health Chemicals Co., Ltd. is A Fine Chemicals Company, specializing in research, development, manufacture and distribute raw materials for pharmaceutical, healthcare, bioch

  •  Suzhou Health Chemicals Co., Ltd.

     China (Mainland)  |  Contact Details

    Business Type:Lab/Research institutions

    Tel:+86-512-58277800

    Address:No. 338, Jingang Avenue,

       Inquiry Now

  • Dtnb,Cas 69-78-3

  • Casno:

    69-78-3

    Dtnb,Cas 69-78-3

    Min.Order: 0

    FOB Price:  USD $ 0.0-0.0

    We are a Union of chemistry in China, consists of chemists,engineers, laboratories,factories in China. We organize surplus capacity of R&D and production as well as custom synthesis for chemical products and chemical business project. We are supp

    We are a Union of chemistry in China, consists of chemists,engineers, laboratories,factories in China. We organize surplus capacity of R&D and production in China for chemicals cus

  •  Bluecrystal chem-union

    China (Mainland)  |  Contact Details

    Business Type:Trading Company

    Tel:+86-1895157

    Address:Liang Xi Qu

       Inquiry Now

  • 5,5'-Dithio-bis-(2-nitrobenzoic acid)

  • Casno:

    69-78-3

    5,5'-Dithio-bis-(2-nitrobenzoic acid)

    Min.Order: 0

    FOB Price:  USD $ 0.0-0.0

    high purity,in stock Package:25kg/drum,or as per customers'demand Application:API,Pharmaceutical intermediates Transportation:air,sea,courier

    GIHI CHEMICALS CO.,LIMITED, its former company is a small manufacturer who is specialized in the production of ester products which are used in the daily chemicals ,cosmetic produc

  •  GIHI CHEMICALS CO.,LIMITED

     China (Mainland)  |  Contact Details

    Business Type:Lab/Research institutions

    Tel:571-86217390

    Address:Huacai International Building,Sandun,Westlake District,Hangzhou 310030,Zhejiang,China

       Inquiry Now

  • 5,5'-Dithiobis(2-nitrobenzoic acid) 69-78-3 with best price

  • Casno:

    69-78-3

    5,5'-Dithiobis(2-nitrobenzoic acid) 69-78-3 with best price

    Min.Order: 0

    FOB Price:  USD $ 0.0-0.0

    with high qualityAppearance:white powder Storage:Store in cool place. Keep container tightly closed in a dry and well-ventilated place. Package:25kg/drum Application:as intermediates Transportation:by courier, air or sea Port:At any port from China

    Hangzhou JINLAN Pharm-Drugs Technology Co., Ltd (JL Pharm) is established in 2012 at the beautiful West Lake – Hangzhou city, China. The company's main business includes R&D, Produ

  •  Hangzhou JINLAN Pharm-Drugs Technology Co., Ltd

     China (Mainland)  |  Contact Details

    Business Type:Manufacturers

    Tel:+86-571-85829053

    Address:Rm A606, Fuyi Center, jianqiao street, Jianggan Area

       Inquiry Now

  • 5,5’-Dithiobis(2-Nitrobenzoic Acid)

  • Casno:

    69-78-3

    5,5’-Dithiobis(2-Nitrobenzoic Acid)

    Min.Order: 0

    FOB Price:  USD $ 0.0-0.0

    Our clients, like BASF,CHEMO,Brenntag,ASR,Evonik,Merck and etc.Appearance:COA Storage:in stock Application:MSDS/TDS

    Xiamen Aeco Chemical Industrial Co., Ltd(same as Aecochem Corp.) An ISO 9001:2015 Certified Company Your Partner in China, a Professional chemical raw material supplier, our

  •  Aecochem Corp.

     China (Mainland)  |  Contact Details

    Business Type:Manufacturers

    Tel:+86-592 599 8717

    Address:No 611 Sishui Road,Huli

       Inquiry Now

Post a RFQ

Enter 15 to 2000 letters.Word count: 0 letters

Attach files(File Format: Jpeg, Jpg, Gif, Png, PDF, PPT, Zip, Rar,Word or Excel Maximum File Size: 3MB)

1

What can I do for you?
Get Best Price

Get Best Price for 69-78-3

Chemistry

Product Name: Dithionitrobenzoic acid (CAS NO.69-78-3)

MF: C14H8N2O8S2
MW: 396.35
IUPAC: 5-(3-carboxy-4-nitrophenyl)disulfanyl-2-nitrobenzoic acid
EINECS: 200-714-4
Melting point: 240-245 °C (dec.)(lit.)
Solubility in water: Soluble
storage temp.: Store at RT.
Appearance: Yellow solid.
Categories: Phenyls & Phenyl-Het;Phenyls & Phenyl-Het
Stability: Stable under normal temperatures and pressures.
Incompatibilities: Strong oxidizing agents.
Decomposition: Nitrogen oxides, carbon monoxide, oxides of nitrogen, oxides of sulfur, irritating and toxic fumes and gases, carbon dioxide, nitrogen.
Synonyms: 3-Carboxy-4-nitrophenyl disulfide; 2,2'-Dinitro-5,5'-dithiodibenzoic acid;  3,3'-Dithiobis(6-nitrobenzoic acid); 5-(3-Carboxy-4-nitrophenyl)disulfanyl-2-nitrobenzoic acid; DTNB

Uses

 Dithionitrobenzoic acid (CAS NO.69-78-3) is used as sensitive reagents to determination sulfhydryl group in protein and polypeptide. Dithionitrobenzoic acid is also used for the monitoring of organophosphorus pesticide poisoning(Cholinesterase determination).

Toxicity Data With Reference

1.    

ipr-mus LD50:2080 mg/kg

    ARZNAD    Arzneimittel-Forschung. Drug Research. 21 (1971),284.

 

Consensus Reports

Reported in EPA TSCA Inventory.

Safety Profile

Moderately toxic by intraperitoneal route. When heated to decomposition it emits toxic vapors of NOx and SOx.
Hazard Codes: Xi
Risk Statements: 36/37/38: Irritating to eyes, respiratory system and skin  
Safety Statements: 26-36
26:  In case of contact with eyes, rinse immediately with plenty of water and seek medical advice 
36:  Wear suitable protective clothing  
WGK Germany: 3
F: 10: Keep under argon.
HS Code: 29309070

Specification

1. First Aid Measures:
Ingestion: If victim is conscious and alert, give 2-4 cupfuls of milk or water. Never give anything by mouth to an unconscious person. Get medical aid.
Inhalation: Remove from exposure to fresh air immediately. If not breathing, give artificial respiration. If breathing is difficult, give oxygen. Get medical aid.
Skin: Flush skin with plenty of soap and water for at least 15 minutes while removing contaminated clothing and shoes. Get medical aid if irritation develops or persists. Wash clothing before reuse.
Eyes: Immediately flush eyes with plenty of water for at least 15 minutes, occasionally lifting the upper and lower eyelids. Get medical aid immediately.