80451-04-3

Basic information

• Product Name: CECROPIN A
• Synonyms: CECROPIN A;CECROPIN A, PORCINE;H-LYS-TRP-LYS-LEU-PHE-LYS-LYS-ILE-GLU-LYS-VAL-GLY-GLN-ASN-ILE-ARG-ASP-GLY-ILE-ILE-LYS-ALA-GLY-PRO-ALA-VAL-ALA-VAL-VAL-GLY-GLN-ALA-THR-GLN-ILE-ALA-LYS-NH2;KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAK-NH2
• CAS NO: 80451-04-3
• Molecular Formula: C184H313N53O46
• Molecular Weight: 4003.78152
• Product Categories: peptide
• Mol File: 80451-04-3.mol
• Article Data: 0

Chemical Properties

• Appearance: /powder
• Storage Temp.: −20°C
• CAS DataBase Reference: CECROPIN A(CAS DataBase Reference)
• NIST Chemistry Reference: CECROPIN A(80451-04-3)
• EPA Substance Registry System: CECROPIN A(80451-04-3)

Safety Data

• WGK Germany: 3
• Hazardous Substances Data: 80451-04-3(Hazardous Substances Data)

Usage

Uses

Different sources of media describe the Uses of 80451-04-3 differently. You can refer to the following data:
1. Cecropin A is an antibacterial peptide originally identified in moths.
2. Cecropin A has been used as an antimicrobial peptide (AMP): to test its cytotoxic effect on breast adenocarcinoma (MDA-MB-231) and human mesothelioma (M14K) cell linesin ultrasensitive radial diffusion assay against E coli to test Galleria mellonella protein 24 and apolipophorin III effectsto test its minimal inhibitory concentrations (MICs) in sensitivity assay for Photorhabdus variants

General Description

Cecropin A belongs to cecropin class and comprises 37 amino acid residues in L configuration. Structurally, this peptide has a C-terminal hydrophobic α-helical structure and the amphipathic N-terminal end. Cecropin A is linear and cationic in nature.

Biochem/physiol Actions

Cecropin A interacts with cell membranes and makes it permeable for electrolytes. Cecropin A thus, favors cytolysis and finally cell death in the hepatocellular carcinoma and lymphoma. The synthetic cecropin A in transgenic rice confers protection against bacterial as well as fungal pathogens.

InChI:InChI=1/C184H313N53O46/c1-27-98(16)145(182(282)235-149(102(20)31-5)181(281)218-115(59-39-46-76-187)159(259)206-103(21)152(252)205-92-138(246)237-82-52-65-130(237)173(273)208-106(24)154(254)228-143(96(12)13)176(276)209-107(25)155(255)229-144(97(14)15)177(277)231-142(95(10)11)175(275)204-89-135(243)211-121(66-70-131(193)239)160(260)207-105(23)156(256)236-150(108(26)238)183(283)221-123(68-72-133(195)241)168(268)232-146(99(17)28-2)178(278)210-104(22)153(253)213-114(151(197)251)58-38-45-75-186)227-137(245)91-202-158(258)129(87-140(249)250)226-163(263)120(64-51-81-200-184(198)199)219-179(279)148(101(19)30-4)234-172(272)128(86-134(196)242)225-164(264)122(67-71-132(194)240)212-136(244)90-203-174(274)141(94(8)9)230-166(266)118(62-42-49-79-190)215-165(265)124(69-73-139(247)248)220-180(280)147(100(18)29-3)233-167(267)119(63-43-50-80-191)214-161(261)116(60-40-47-77-188)216-170(270)126(84-109-53-33-32-34-54-109)224-169(269)125(83-93(6)7)223-162(262)117(61-41-48-78-189)217-171(271)127(222-157(257)112(192)56-37-44-74-185)85