Welcome to LookChem.com Sign In|Join Free
  • or
Home > Pharmaceutical > 863288 > 

863288-34-0

Basic Information
CAS No.: 863288-34-0
Name: CJC1295
Molecular Structure:
Molecular Structure of 863288-34-0 (CJC1295)
Formula: C159H258N46O45
Molecular Weight: 3534.03
Synonyms: CJC-1295;
Density: 1.45
Appearance: White Lyophilized Powder
PSA: 1513.38000
LogP: 5.02680
  • Display:default sort

    New supplier

  • CJC1295 CAS :863288-34-0

  • Casno:

    863288-34-0

    CJC1295 CAS :863288-34-0

    Min.Order: 1 Kilogram

    FOB Price:  USD $ 9.0-99.0

    Our advantages: 1. All inquiries will be replied within 12 hours. 2. Dedication to quality, supply & service. 3. Strictly on selecting raw materials. 4. Reasonable & competitive price, fast lead time. 5. Sample is available for your eva

    Our company specializes in processing and selling chemical raw materials, chemical th Asia, Europe, America, Africa and other more than 20 countries and regions. ? Companies adheri

  •  Hebei Nengqian Chemical Import and Export Co., LTD

     China (Mainland)  |  Contact Details

    Business Type:Trading Company

    Tel:+86 13910575315

    Address:hebei

       Inquiry Now

  • CJC1295 (DAC) CAS 863288-34-0

  • Casno:

    863288-34-0

    CJC1295 (DAC) CAS 863288-34-0

    Min.Order: 1 box

    FOB Price:  USD $ 90.0-100.0

    1, High quality with competitive price: 1) Standard:BP/USP/EP/Enterprise standard 2) All Purity≥99% 3) We are manufacturer and can provide high quality products with factory price. 2, Fast and safe delivery 1) Parcel can be sent out in 24 ho

  •  Qiuxian Yanjia Trading Co., Ltd

    China (Mainland)  |  Contact Details

    Business Type:Trading Company

    Tel:13292809875

    Address:hebei

       Inquiry Now

  • Bodybuilding peptide CJC-1295 does not contain DAC CAS NO.863288-34-0

  • Casno:

    863288-34-0

    Bodybuilding peptide CJC-1295 does not contain DAC CAS NO.863288-34-0

    Min.Order: 1 Gram

    FOB Price:  USD $ 0.0-0.0

    Beluga chemical professional supply Bodybuilding peptide CJC-1295 does not contain DAC CAS NO.863288-34-0 1. Beluga Chemical has a professional RESEARCH and development team and strong technical force to ensure technical support and research capab

    Qingdao Belugas Import and Export Co., Ltd. is a scientific and technological company integrating research and development, production and trade of chemical intermediates, speciali

  •  Qingdao Beluga Import and Export Co., LTD

     China (Mainland)  |  Contact Details

    Business Type:Lab/Research institutions

    Tel:+8613854236000

    Address:qingdao

       Inquiry Now

  • High purity CJC1295(DAC) CAS 863288-34-0

  • Casno:

    863288-34-0

    High purity CJC1295(DAC) CAS 863288-34-0

    Min.Order: 1 Gram

    FOB Price:  USD $ 1.0-1.0

    Our advantages: 1, High quality with competitive price: 1) Standard:BP/USP/EP/Enterprise standard 2) All Purity≥99% 3) We are manufacturer and can provide high quality products with factory price. 2, Fast and safe delivery 1) Parcel can be

    HEALTHTIDE BIOTECH CO.,LTD is a collection of production and sales of biotechnology companies.Our company mainly sells plant extracts, chemical raw materials,food additives,raw mat

  •  healthtide biotech co.,ltd

     China (Mainland)  |  Contact Details

    Business Type:Trading Company

    Tel:+852 65031356

    Address:No. 45 Beijing Road, Qianwan Free Trade Port, Qingdao Area, China Pilot Free Trade Zone

       Inquiry Now

  • CJC 1295

  • Casno:

    863288-34-0

    CJC 1295

    Min.Order: 1 Kilogram

    FOB Price:  USD $ 0.0-0.0

    Hello, dear friend! I'm Hansen and Allen from China. Welcome to my lookchem mall! The following is a brief introduction of our company's products and services. If you are interested in our products, please contact us by emai

    Shandong Hanjiang Chemical Co., Ltd. is located in Zibo City, Shandong Province, China. It is a biotechnology enterprise engaged in the R&D, production and sales of drugs, steroids

  •  Shandong Hanjiang Chemical Co., Ltd.

     China (Mainland)  |  Contact Details

    Business Type:Lab/Research institutions

    Tel:+86 18369939125

    Address:No.25A Qilu Industrial Park

       Inquiry Now

  • CJC-1295 Bodybuilding peptide CJC-1295 CAS NO.863288-34-0

  • Casno:

    863288-34-0

    CJC-1295 Bodybuilding peptide CJC-1295 CAS NO.863288-34-0

    Min.Order: 1 Gram

    FOB Price:  USD $ 0.0-0.0

    In stock: Top-sell products are always in stock. High Purity: More than 99% Strong research team Quality :High quality Packing method: bagged, boxed, bottled,barreled (customer needs packing methods) Customer Service: If you need us to provide samp

    SHENGZHIKAI TECHNOLOGY INDUSTRY CO., LTD is a high-tech enterprise dedicated to the fields of fine chemical products. The scope of products covers pharmaceutical intermediates, pla

  •  SHENGZHIKAI TECHNOLOGY INDUSTRY CO., LTD

    China (Mainland)  |  Contact Details

    Business Type:Trading Company

    Tel:+86 17681166510

    Address:903, block B, Fortune Plaza, Luyang District, Hefei City, Anhui Province

       Inquiry Now

  • CJC-1295

  • Casno:

    863288-34-0

    CJC-1295

    Min.Order: 10 Gram

    FOB Price:  USD $ 100.0-100.0

    Zibo Hangyu Biotechnology Development Co., Ltd is a leading manufacturer and supplier of chemicals in China. We develop produce and distribute high quality pharmaceuticals, intermediates, special chemicals and OLED intermediates and other fine chemi

    Hangyu Biotech is a leading manufacturer and supplier of chemicals in China. We develop produce and distribute high quality pharmaceuticals, intermediates, special chemicals and O

  •  Zibo Hangyu Biotechnology Development Co., Ltd

    China (Mainland)  |  Contact Details

    Business Type:Lab/Research institutions

    Tel:86-15965530500

    Address:Room1701, Tianxing Building,Licheng district, jinan, Shandong, China

       Inquiry Now

  • CJC1295   manufacturer with low price

  • Casno:

    863288-34-0

    CJC1295 manufacturer with low price

    Min.Order: 1 Gram

    FOB Price:  USD $ 0.0-0.0

    We can provide GMP validation service that complies with SFDA, FDA, WHO and EU EMPA.Excellent registration team could help us easlily to register our products in different countries.If you and your customer are interested in some products or need C

    Hangzhou JINLAN Pharm-Drugs Technology Co., Ltd (JL Pharm) is established in 2012 at the beautiful West Lake – Hangzhou city, China. The company's main business includes R&D, Produ

  •  Hangzhou JINLAN Pharm-Drugs Technology Co., Ltd

     China (Mainland)  |  Contact Details

    Business Type:Manufacturers

    Tel:+86-571-85829053

    Address:Rm A606, Fuyi Center, jianqiao street, Jianggan Area

       Inquiry Now

  • CJC-1295 Acetate without DAC 863288-34-0

  • Casno:

    863288-34-0

    CJC-1295 Acetate without DAC 863288-34-0

    Min.Order: 1 Gram

    FOB Price:  USD $ 0.0-0.0

    1.High quality : the purity is 99% min . through multiple producing procedures. 2.Competitive price : low price because of our skilled production technolpgy ,save the production cost at most , and give big profit room to our customers

    Wuhan Fortuna Chemical Co., Ltd, located in the predominant Wu Han City where is a traffic hinge of China, is a big integrative chemical enterprise being engaged in producing and

  •  Wuhan Fortuna Chemical Co.,Ltd

     China (Mainland)  |  Contact Details

    Business Type:Trading Company

    Tel:86-27-59207850

    Address:Add: Room 2015, No.2 Building, Kaixin Mansion No.107 Jinqiao Avenue, Wuhan, China

       Inquiry Now

  • High Quality 99% CJC-1295 863288-34-0 GMP manufacturer

  • Casno:

    863288-34-0

    High Quality 99% CJC-1295 863288-34-0 GMP manufacturer

    Min.Order: 1 Gram

    FOB Price:  USD $ 0.1-0.1

    1. Factory price and high quality must be guaranteed, base on 8 years of production and R&D experience2. Free samples will be provided,ensure specifications and quality are right for customer3. Customers will receive the most professional technical s

    Xi'an Xszo Chem Co. Ltd is a wholly-owned subsidiary of the SZO Chem Group. SZO Group is composed of Xi'an Xszo Chem Co. Ltd & Shaanxi SZO Tech Co., Ltd. SZO industry Group have mo

  •  Xi'an Xszo Chem Co., Ltd.

     China (Mainland)  |  Contact Details

    Business Type:Manufacturers

    Tel:+86-029-88698540

    Address:No.16,Jingqin Rd. JingWei Industrial park,Shaanxi,China,710200

       Inquiry Now

  • lower price High quality CJC-1295

  • Casno:

    863288-34-0

    lower price High quality CJC-1295

    Min.Order: 1 Kilogram

    FOB Price:  USD $ 1.0-1.0

    Shanghai Seasonsgreen Chemical is a high-tech research and development, production, sale and custom synthesis set in one high-tech chemical products enterprises. Our sales and marketing division is located in Shanghai, serving international pharmaceu

    Shanghai Seasonsgreen Chemical is a high-tech research and development, production, sale and custom synthesis set in one high-tech bio chemical products enterprises. The company's

  •  Shanghai Seasonsgreen Chemical Co.,Ltd

     China (Mainland)  |  Contact Details

    Business Type:Manufacturers

    Tel:+86 156 1855 4368

    Address:No.12, Lane 356, Chengnan Road, Chuansha Town, Shanghai

       Inquiry Now

  • CJC 1295 (2mg/vial) CAS NO.863288-34-0

  • Casno:

    863288-34-0

    MSDS/COA Download

    CJC 1295 (2mg/vial) CAS NO.863288-34-0

    Min.Order: 1 Kilogram

    FOB Price:  USD $ 1.0-3.0

    Quick Details ProName: CJC 1295 (2mg/vial) CasNo: 863288-34-0 Molecular Formula: C152H252N44O42 Appearance: white Application: Bodybuilding DeliveryTime: 3-4 days PackAge: Disguised package Port: Hongkong Pr

    Hebei yanxi chemical co. LTD. has expanded a compositive entity from initially only as a small manufacturer. The company dedicated to the development, production and marketing of

  •  Hebei yanxi chemical co.,LTD.

    China (Mainland)  |  Contact Details

    Business Type:Trading Company

    Tel:86-0311-66561638

    Address:Zhang zhe, guangzong county, xingtai city, hebei province

       Inquiry Now

  • CJC1295/cas:863288-34-0/Raw material spot

  • Casno:

    863288-34-0

    CJC1295/cas:863288-34-0/Raw material spot

    Min.Order: 25 Kilogram

    FOB Price:  USD $ 1.0-2.0

    Name:CJC1295 CAS NO: 863288-34-0 Grade:Medical scientific research and export Molecular formula:C152H252N44O42 Molecular weight:3367.89688 Product Quality 12 years of chemical raw materials Mature operation of the industry System stability

    Hubei DiBo chemical co., LTD Hubei DiBo Chemical Co., Ltd. was founded in 2009, is located in Hubei Province on both sides of the Yangtze River, one of the ancient cities of Chines

  •  Hubei DiBo chemical co., LTD

     China (Mainland)  |  Contact Details

    Business Type:Other

    Tel:+86 15871366807

    Address:No. 782 of wuchang district of wuhan city, hubei province

       Inquiry Now

  • CJC1295

  • Casno:

    863288-34-0

    CJC1295

    Min.Order: 1 Kilogram

    FOB Price:  USD $ 0.9-1.0

    Advantage : LIDE PHARMACEUTICALS LTD. is a mid-small manufacturing-type enterprise, engaged in pharmaceutical intermediates of R&D, custom-made and production, and also involving trading chemicals for export. We have established the R&

    LIDE PHARMACEUTICALS LIMITED is one of the fastest growing pharmaceutical company in China. We have developed strategic partnership with our manufacturing associates having state o

  •  LIDE PHARMACEUTICALS LIMITED

    China (Mainland)  |  Contact Details

    Business Type:Lab/Research institutions

    Tel:+86-25-58409506

    Address:11F, Building A1, No.288 North Zhongshan Road, Gulou District, Nanjing,210003, P.R.China.

       Inquiry Now

  • CJC-1295/dac      99%

  • Casno:

    863288-34-0

    CJC-1295/dac 99%

    Min.Order: 1 Milligram

    FOB Price:  USD $ 0.0-0.0

    Our Advantage: high quality with competitive price High quality standard: BP/USP/EP Enterprise standard All purity customized Fast and safe delivery We have reliable forwarder who can help us deliver our goods more fast and safe. We

    Wuhan Han Sheng New Material Technology Co. Ltd is a professional company which specialized in manufacturing and selling chemical raw materials, chemical products, pharmaceutical i

  •  Wuhan Han Sheng New Material Technology Co.,Ltd

    China (Mainland)  |  Contact Details

    Business Type:Trading Company

    Tel:17798174412

    Address:Room 401, Floor 4, Building 3-1, Guandong Science and Technology Industrial Park, Jiayuan Road, Guandong Street, Donghu Hi tech Development Zone, Wuhan

       Inquiry Now

  • CJC1295 CAS863288-34-0

  • Casno:

    863288-34-0

    CJC1295 CAS863288-34-0

    Min.Order: 1 Kilogram

    FOB Price:  USD $ 289.0-499.0

    1. Product advantages ♦ High purity, all above 98.5%, no impurities after dissolution ♦ We will test each batch to ensure quality ♦ OEM and private brand services designed for free ♦ Various cap colors available ♦ W

    Hebei Sankai Chemical Technology Co., Ltd. is a new chemical enterprise integrating the research, manufacturing and supply of chemicals. Located in the beautiful "cattle city" Xing

  •  Hebei Sankai Chemical Technology Co., Ltd

     China (Mainland)  |  Contact Details

    Business Type:Trading Company

    Tel:+86 15932099601

    Address:hebei

       Inquiry Now

  • CJC 1295 863288-34-0

  • Casno:

    863288-34-0

    CJC 1295 863288-34-0

    Min.Order: 1 Kilogram

    FOB Price:  USD $ 0.0-0.0

    1.No Less 8 years exporting experience. Clients can 100% received goods 2.Lower Price with higher quality 3,Free sample 4,We are sincerely responsible for the "product quality" and "After Service" Upbio is Specialized

    Shanghai Upbio Tech Co.,Ltd (Former Onchem (China)Co.,Ltd) is a comprehensive manufacturer and an international distribution of chemicals throughout the world, The predecessor of

  •  Shanghai Upbio Tech Co.,Ltd

     China (Mainland)  |  Contact Details

    Business Type:Lab/Research institutions

    Tel:+86-21-52196435

    Address:No.2 Floor,No.979 Yunhan Rd,Nicheng,Pudong New Area,Shanghai,China

       Inquiry Now

  • Peptides Bodybuilding cjc-1295 cjc 1295 Without dac 863288-34-0

  • Casno:

    863288-34-0

    Peptides Bodybuilding cjc-1295 cjc 1295 Without dac 863288-34-0

    Min.Order: 1 Kilogram

    FOB Price:  USD $ 0.0-0.0

    We have overseas warehouses in California, New Laredo Mexico, Vancouver Canada, Amsterdam Netherlands, and Melbourne Australia. Overseas warehouses can provide some of the best-selling products. We look forward to the cooperation of local powerful d

    Shanghai Terui OP New Material Technology Co., Ltd. is a company dedicated to the research and development, production and sales of organic compounds, pharmaceutical intermediates

  •  Shanghai Terui OP New Material Technology Co., Ltd.

    China (Mainland)  |  Contact Details

    Business Type:Trading Company

    Tel:+86 18126314766

    Address:Room 901, Building 11, Lane 388, Baifu Road, Fengxian District, Shanghai,

       Inquiry Now

  • Factory supply  CJC1295

  • Casno:

    863288-34-0

    Factory supply CJC1295

    Min.Order: 1 Kilogram

    FOB Price:  USD $ 0.0-0.0

    CJC1295 CAS: 863288-34-0 Specification Item Specifications Product Name CJC/1295 Appearance White freeze-dried powder Purity 98%min Boiling point 1265.3ºC at 760 mmHg Density

    Lonwin industry group limited.is a comprehensive chemical enterprise which mainly integrates development, production, marketing ,import and export business. The company is located

  •  Lonwin Chemical Group Limited

     China (Mainland)  |  Contact Details

    Business Type:Other

    Tel:Tel: 86-21-59858395

    Address:No#966,Huaxu Road,Shanghai 201702,P.R.China

       Inquiry Now

  • CJC-1295

  • Casno:

    863288-34-0

    MSDS/COA Download

    CJC-1295

    Min.Order: 1 Kilogram

    FOB Price:  USD $ 80.0-100.0

    1. Timely and efficient service to ensure communication with customers 2. Produce products of different specifications and sizes according to your requirements. 3. Quality procedures and standards recognized by SGS. Advanced plant equipment ensures

    Hebei Quanhe Biotechnology Co. LTD. is an enterprise specializing in the research and development, production and trade of pharmaceutical intermediates, apis and chemical raw mater

  •  Hebei Quanhe Biotechnology Co. LTD

    China (Mainland)  |  Contact Details

    Business Type:Lab/Research institutions

    Tel:+8619003195089

    Address:Haida Business Center, Xiangdu District

       Inquiry Now

  • CJC 1295

  • Casno:

    863288-34-0

    CJC 1295

    Min.Order: 0

    FOB Price:  USD $ 0.0-0.0

    Henan Wentao Chemical Product Co.,Ltd is Located in Zhengzhou High-tech Development Zone with import and export license, We passed ISO 9001:2008 as well, Henan Wentao has developed more than 1000 compounds, which are widely used in the fields of prod

    The company is Located in Zhengzhou High-tech Development Zone with import and export license, We passed ISO 9001:2008 as well, Henan Wentao has developed more than 1000 compounds,

  •  Henan Wentao Chemical Product Co., Ltd.

     China (Mainland)  |  Contact Details

    Business Type:Lab/Research institutions

    Tel:+86-370-2722992

    Address:32 Room, 5th Floor, Building 11, No. 6 Yinxing Road, High-tech Industrial Development Zone, Zhengzhou City, Henan Province

       Inquiry Now

  • Global Sell CJC-1295 Without Dac, CJC1295 No Dac, Cjc 1295

  • Casno:

    863288-34-0

    Global Sell CJC-1295 Without Dac, CJC1295 No Dac, Cjc 1295

    Min.Order: 1 Gram

    FOB Price:  USD $ 0.0-0.0

    Sichuan Jisheng Biopharmaceutical Co.,Ltd is specializing of peptide and pharmaceutical intermediates. all of our products are produced in accordance with GMP standard and are exceeded in international quality standards. We are a leading peptide

    Our company is located in Deyang, a typical city of Sichuan - with beautiful scenery and mild climate. It occupies a total area of 16,000 square meters. We are a specialized manufa

  •  SICHUAN TONGSHENG AMINOACID CO.LTD

     China (Mainland)  |  Contact Details

    Business Type:Manufacturers

    Tel:86-838-2274206/2850606

    Address:Room 1-11-1,No.19 of North TianShan Road,Deyang,Sichuan China

       Inquiry Now

  • CJC-1295

  • Casno:

    863288-34-0

    CJC-1295

    Min.Order: 1 Gram

    FOB Price:  USD $ 55.0-60.0

    Service: 1. Any inquiries will be replied within 12 hours. 2. Dedication to quality, supply & service. 3. Strictly on selecting raw materials. 4. OEM/ODM Available. 5. Reasonable & competitiv

    Triumph International Development Limilted is engaged in the API, pharmaceutical intermediates research and developmen.Adhering to the "customer first" business philosophy,we suppl

  •  Triumph International Development Limilted

    China (Mainland)  |  Contact Details

    Business Type:Lab/Research institutions

    Tel:+86-536-7971999

    Address:Yinhai Road,Shouguang

       Inquiry Now

  • Factory Supply Supplement 99% Purity  CJC-1295 cas 863288-34-0

  • Casno:

    863288-34-0

    Factory Supply Supplement 99% Purity CJC-1295 cas 863288-34-0

    Min.Order: 1 box

    FOB Price:  USD $ 20.0-50.0

    Note:Due to policy changes, some products have not been disclosed on here. However, you can still ask us for quotations please leave me a message。 If you couldn't find the product you want in our store, maybe we haven't uploaded the co

    Shanghai Chinqesen Biotechnology Co., Ltd. Company slogan:Innovation, cooperation and win-win Company introduction:Shanghai Chinqesen Biotechnology Co., Ltd. is a professional phar

  •  Shanghai Chinqesen Biotechnology Co., Ltd.

    China (Mainland)  |  Contact Details

    Business Type:Trading Company

    Tel:+8617316470195

    Address:333 Songze Avenue, Qingpu District, Shanghai

       Inquiry Now

  • CJC-1295 (Without DAC)

  • Casno:

    863288-34-0

    CJC-1295 (Without DAC)

    Min.Order: 0 Metric Ton

    FOB Price:  USD $ 0.0-0.0

    Hangzhou KeyingChem Co., Ltd. exported this product to many countries and regions at best price. If you are looking for the material’s manufacturer or supplier in China, KeyingChem is your best choice. Pls contact with us freely for getting det

    Hangzhou Keying Chem Co., Ltd. Is a comprehensive enterprise, dedicated to the development, production and marketing of chemicals. As a technology innovative and service profession

  •  Hangzhou Keyingchem Co.,Ltd

     China (Mainland)  |  Contact Details

    Business Type:Lab/Research institutions

    Tel:+86-571-85378921

    Address:Jintong international Building, No.113,Huayuangang Street, Gong shu District, Hangzhou,Zhejiang, China.

       Inquiry Now

  • CAS 863288-34-0 Quality Peptides Factory Price Cjc-1295

  • Casno:

    863288-34-0

    CAS 863288-34-0 Quality Peptides Factory Price Cjc-1295

    Min.Order: 1 Kilogram

    FOB Price:  USD $ 8.0-11.0

    High Purity CAS 863288-34-0 Quality Peptides Factory Price Cjc-1295 proname: cjc 1295 (2mg/vial) casno: 863288-34-0 molecular formula: c152h252n44o42 appearance: white application: bodybuilding deliverytime: 3-4 days Description:

    SaiWanTe (Shanghai) New Material Technology Co.,Ltd , located in shanghai ,China. It is specialized in the R&D, production and sales of chemical raw matereials, cosmetic additives,

  •  Saiwante (shanghai) New Material Technology Co., Ltd.

    China (Mainland)  |  Contact Details

    Business Type:Trading Company

    Tel:17733953109

    Address:3/F AND 4/F NO.1 LANE 65 HUANLONG RD.CHINA(SHANGHAI) PILOT FREE TRADE ZONE

       Inquiry Now

  • CJC-1295 (Without DAC)

  • Casno:

    863288-34-0

    CJC-1295 (Without DAC)

    Min.Order: 100 Gram

    FOB Price:  USD $ 100.0-2000.0

    We are one of a few suppliers that can offer custom synthesis service of this product We are specialized in custom synthesis, chemical/pharmaceutical/ pesticides outsourcing and contract research. We are committed to prov

    SHANGHAI SYSTEAM BIOCHEM CO., LTD. is one of the professional suppliers in Chinese pharmaceutical market and is specialized in custom synthesis, chemical/pharmaceutical/ pesticides

  •  SHANGHAI SYSTEAM BIOCHEM CO., LTD

     China (Mainland)  |  Contact Details

    Business Type:Lab/Research institutions

    Tel:86-021-58380978

    Address:Building 87,Lane 669, Dong Jing Road Shanghai,P.R.China

       Inquiry Now

  • CJC 1295

  • Casno:

    863288-34-0

    CJC 1295

    Min.Order: 1 Gram

    FOB Price:  USD $ 0.0-0.0

    Superior quality, moderate price & quick delivery. Appearance:White Lyophilized Powder Storage:Stored in cool, dry and ventilation place; Away from fire and heat Package:1kg/bag, 1kg/drum or 25kg/drum or as per your request. Application:Used as

    Hangzhou Yunuo Chemical Co., Ltd. is located in Hangzhou City, China We are specialized in fine chemicals and basic chemical auxiliary materials, Organic compounds, rubber

  •  HANGZHOU YUNUO CHEMICAL CO.,LTD

     China (Mainland)  |  Contact Details

    Business Type:Trading Company

    Tel:0571-83715115

    Address:hangzhou

       Inquiry Now

  • Pharmaceutical CJC-1295 Powder CAS 863288-34-0

  • Casno:

    863288-34-0

    Pharmaceutical CJC-1295 Powder CAS 863288-34-0

    Min.Order: 1 Kilogram

    FOB Price:  USD $ 8.2-8.8

    1. A strong scientific research team . 2. Stable quality (with a complete scientific research center and testing center to ensure the quality stability of each batch of products). 3. Rich export experience (with practical experience in exporting to m

    Hebei Kunsui Technology Co., Ltd. specializes in exporting high quality Pharmaceutical raw materials, medical devices, plant extract, pesticide raw materials and Chemical raw mate

  •  Hebei Kunsui Technology Co., Ltd.

    China (Mainland)  |  Contact Details

    Business Type:Trading Company

    Tel:+8613343103587

    Address:Shijiazhuang City, Hebei Province

       Inquiry Now

  • TIANFUCHEM--CJC1295

  • Casno:

    863288-34-0

    TIANFUCHEM--CJC1295

    Min.Order: 1 Metric Ton

    FOB Price:  USD $ 20.0-20.0

    Product Name: CJC1295 Synonyms: CJC1295;Y(d -A)DAIFTQSYRKVLAQLSARKLLQDILSR-NH2;L-Tyrosyl-D-alanyl-L-alpha-aspartyl-L-alanyl-L-isoleucyl-L-phenylalanyl-L-threonyl-L-glutaminyl-L-seryl-L-tyrosyl-L-arginyl-L-lysyl

    Our company engages in Electronic chemicals such as OLED,Photoresist chemical,Electrolyte additive and Intermediate Pharmaceutical production; development of noble metal catalysts,

  •  Henan Tianfu Chemical Co., Ltd.

     China (Mainland)  |  Contact Details

    Business Type:Lab/Research institutions

    Tel:86-371-55170693/55170694

    Address:Zhengzhou International Trade New Territory,Jinshui District,Zhengzhou ,China

       Inquiry Now

  • CJC1295 Whitout DAC

  • Casno:

    863288-34-0

    CJC1295 Whitout DAC

    Min.Order: 10 box

    FOB Price:  USD $ 25.0-25.0

    quality Stable quality With a complete scientific research center and testing center to ensure the quality stability of each batch of products. delivery Safe and fast delivery Most products have a large inventory, so the

    Zhengzhou strong peptide cross-border e-commerce Co., Ltd. is a high-tech chemical enterprise in Central China, specializing in the chemical raw materials and intermediates.Since i

  •  Zhengzhou strong peptide cross-border e-commerce Co., Ltd

    China (Mainland)  |  Contact Details

    Business Type:Trading Company

    Tel:139-300-71710

    Address:Building A, Yiyuan International Building, No.319, Xinyi Road, Zhengzhou Area, Henan Pilot Free Trade Zone Room 815

       Inquiry Now

  • High Quality CJC-1295(Without DAC)

  • Casno:

    863288-34-0

    High Quality CJC-1295(Without DAC)

    Min.Order: 1 Kilogram

    FOB Price:  USD $ 0.0-0.0

    Product name: CJC-1295(Without DAC) CAS No.:863288-34-0 Molecule Formula:C159H258N46O45 Molecule Weight:3367.90 Purity: 98.0% Package: 1g/bag Description:White powder Manufacture Standards:Enterprise Standard TESTI

    Siwei Development Group Ltd. is a reputed professional enterprise in China dedicated to the Amino Acids production and sales of fine chemical products.Over the years we have been m

  •  Siwei Development Group Ltd.

    China (Mainland)  |  Contact Details

    Business Type:Trading Company

    Tel:86-571-82881840

    Address:Rm2-2-503 Zhongdingyuan, Xianghurenjia Wenyan Xiaoshan, Hangzhou China

       Inquiry Now

  • CJC1295

  • Casno:

    863288-34-0

    CJC1295

    Min.Order: 1 Gram

    FOB Price:  USD $ 0.0-0.0

    Product Details Grade: pharmaceutical grade Purity:99%+ ProductionCapacity: 1000 Kilogram/Month Scope of use: For scientific research only(The product must be used legally) Our Advantage 1. Best quality with competitive price. 2. Quick shipping,

    Zibo Dorne chemical technology co., LTD. is a biotechnology enterprise engaged in the R&D, production and sales of drugs, steroids, peptides, raw materials, vitamins, food additive

  •  Zibo Dorne chemical technology co. LTD

     China (Mainland)  |  Contact Details

    Business Type:Lab/Research institutions

    Tel:+86-18560316533

    Address:No. 416, 4th floor, zhongguancun science and technology city, no. 1, west 6th road, zhangdian district

       Inquiry Now

  • Top Purity CJC1295

  • Casno:

    863288-34-0

    Top Purity CJC1295

    Min.Order: 0

    FOB Price:  USD $ 0.0-0.0

    Our Advantages A. International Top level TechnologyOur company owned biomedicine experts are famous at home and abroad with rich experience in research and development in the field of efficient chiral functional molecules research and development an

    Jiangsu Qianyu Molecular Technology Co., LTD. Jiangsu Qianyu Molecular Technology is a high-tech medical and health enterprise,located in a developed transportation city Xuzhou, Ch

  •  Jiangsu Qianyu Molecular Technology Co., LTD.

    China (Mainland)  |  Contact Details

    Business Type:Trading Company

    Tel:+86 18652199763

    Address:No.2-812, Zhongyin Plaza,Yunlong District

       Inquiry Now

  • CJC1295

  • Casno:

    863288-34-0

    CJC1295

    Min.Order: 1 Milligram

    FOB Price:  USD $ 0.0-0.0

    GMP standard, high purity, competitive price, in stock 1. Quick Response: within 6 hours after receiving your email. 2. Quality Guarantee: All products are strictly tested by our QC, confirmed by QA, and approved by a third-party lab in China, USA,

  •  Xiamen Jenny Chemical Technology Co., Ltd.

     China (Mainland)  |  Contact Details

    Business Type:Trading Company

    Tel:+86

    Address:xiameng

       Inquiry Now

  • API Peptides MGF Powder Dosage Usage Effect and Benefit

  • Casno:

    863288-34-0

    API Peptides MGF Powder Dosage Usage Effect and Benefit

    Min.Order: 1 Kilogram

    FOB Price:  USD $ 18.0-20.0

    factory?direct?saleAppearance:White Powder Storage:Store In Dry, Cool And Ventilated Place Package:25kg/drum, also according to the clients requirement Application:It is widely used as a thickener, emulsifier and stabilizer Transportation:By Sea Or B

    Founded in 2008, East Chemsources Limited is a professional manufacturer of supplier in food and beverage, pharmaceuticals, cosmetics and other industries. pharmaceutical field in

  •  EAST CHEMSOURCES LIMITED

     China (Mainland)  |  Contact Details

    Business Type:Trading Company

    Tel:15053231572

    Address:No.1581-12,Jinshui Road, Licang, Qingdao,China

       Inquiry Now

  • CJC-1295

  • Casno:

    863288-34-0

    CJC-1295

    Min.Order: 1 Gram

    FOB Price:  USD $ 0.0-0.0

    1.High Quality: Quality is life. Quality is the most important element for all goods. We have a lab doing research in Wuhan China and produce sarms in bulk quantity. We have 8 years experience making all kinds of sarms. And all our old customers thr

    WUHAN WONDA PHARMACEUTICAL AND CHEMICAL LIMITED is specializing in custom synthesis, manufacture and import & export of nootropics, herbal extract, OLED etc. Wuhan Wonda Pharm & Ch

  •  Wuhan Wonda Pharm Limited

    China (Mainland)  |  Contact Details

    Business Type:Lab/Research institutions

    Tel:027-84306245

    Address:Wuhan Private Science and Technology Park , Wuhan, China

       Inquiry Now

Post a RFQ

Enter 15 to 2000 letters.Word count: 0 letters

Attach files(File Format: Jpeg, Jpg, Gif, Png, PDF, PPT, Zip, Rar,Word or Excel Maximum File Size: 3MB)

1

What can I do for you?
Get Best Price

Get Best Price for 863288-34-0